Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSH SAGRTPGRTPGKSSSKVQTTPSKPGGDRYIPHRSAAQMEVASFLLSKENQ
    • Molecular weight
      37 kDa including tags
    • Amino acids
      1 to 100

Specifications

Our Abpromise guarantee covers the use of ab114348 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • bA276H19.3
    • Cdc 20
    • CDC20
    • CDC20 cell division cycle 20 homolog
    • CDC20_HUMAN
    • CDC20A
    • Cell division cycle 20
    • Cell division cycle 20 homolog
    • Cell division cycle 20 homolog (S. cerevisiae)
    • Cell division cycle protein 20 homolog
    • fizzy
    • MGC102824
    • p55CDC
    see all
  • Function
    Required for full ubiquitin ligase activity of the anaphase promoting complex/cyclosome (APC/C) and may confer substrate specificity upon the complex. Is regulated by MAD2L1. In metaphase the MAD2L1-CDC20-APC/C ternary complex is inactive and in anaphase the CDC20-APC/C binary complex is active in degrading substrates.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Belongs to the WD repeat CDC20/Fizzy family.
    Contains 7 WD repeats.
  • Developmental stage
    Synthesis is initiated at G1/S, protein level peaks in M phase and protein is abruptly degraded at M/G1 transition.
  • Post-translational
    modifications
    Phosphorylated during mitosis, probably by maturation promoting factor (MPF). Phosphorylated by BUB1 at Ser-41; Ser-72; Ser-92; Ser-153; Thr-157 and Ser-161.
    Ubiquitinated and degraded by the proteasome during spindle assembly checkpoint. Deubiquitinated by USP44, leading to stabilize the MAD2L1-CDC20-APC/C ternary complex, thereby preventing premature activation of the APC/C.
  • Information by UniProt

Recombinant Human Cdc20 protein images

  • ab114348 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human Cdc20 protein (ab114348)

ab114348 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114348.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up