Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MVPVAVTAAVAPVLSINSDFSDLREIKKQLLLIAGLTRERGLLHSSKWSA ELAFSLPALPLAELQPPPPITEEDAQDMDAYTLAKAYFDVKEYDRAAHFL HGCNSKKAYFLYMYSRYLSGEKKKDDETVDSLGPLEKGQVKNEALRELRV ELSKKHQARELDGFGLYLYGVVLRKLDLVKEAIDVFVEATHVLPLHWGAW LELCNLITDKEMLKFLSLPDTWMKEFFLAHIYTELQLIEEALQKYQNLID VGFSKSSYIVSQIAVAYHNIRDIDKALSIFNELRKQDPYRIENMDTFSNL LYVRSMKSELSYLAHNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQR ALKLNPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLG QTYEILKMPFYCLYYYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCY WRAYAVGDVEKMALVKLAKLHEQLTESEQAAQCYIKYIQDIYSCGEIVEH LEESTAFRYLAQYYFKCKLWDEASTCAQKCCAFNDTREEGKALLRQILQL RNQGETPTTEVPAPFFLPASLSANNTPTRRVSPLNLSSVTP
    • Amino acids
      1 to 591
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152908 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ANAPC8
    • Anaphase promoting complex subunit 8
    • Anaphase-promoting complex subunit 8
    • Apc 8
    • APC8
    • Cdc 23
    • CDC23
    • CDC23_HUMAN
    • cell division cycle 23
    • Cell division cycle 23 homolog
    • Cell division cycle protein 23
    • Cell division cycle protein 23 homolog
    • Cut23
    • Cyclosome subunit 8
    see all
  • Function
    Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Belongs to the APC8/CDC23 family.
    Contains 9 TPR repeats.
  • Post-translational
    modifications
    Phosphorylated. Phosphorylation on Thr-562 occurs specifically during mitosis.
  • Information by UniProt

Images

  • ab152908 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152908 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152908.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up