Recombinant human Cdc25B protein (ab105906)

Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MEVPQPEPAPGSALSPAGVCGGAQRPGHLPGLLLGSHGLLGSPVRAAASS PVTTLTQTMHDLAGLGSETPKSQVGTLLFRSRSRLTHLSLSRRASESSLS SESSESSDAGLCMDSPSPMDPHMAEQTFEQAIQAASRIIRNEQFAIRRFQ SMPVRLLGHSPVLRNITNSQAPDGRRKSEAGSGAASSSGEDKENDGFVFK MPWKPTHPSSTHALAEWASRREAFAQRPSSAPDLMCLSPDRKMEVEELSP LALGRFSLTPAEGDTEEDDGFVDILESDLKDDDAVPPGMESLISAPLVKT LEKEEEKDLVMYSKCQRLFRSPSMPCSVIRPILKRLERPQDRDTPVQNKR RRSVTPPEEQQEAEEPKARVLRSKSLCHDEIENLLDSDHRELIGDYSKAF LLQTVDGKHQDLKYISPETMVALLTGKFSNIVDKFVIVDCRYPYEYEGGH IKTAVNLPLERDAESFLLKSPIAPCSLDKRVILIFHCEFSSERGPRMCRF IRERDRAVNDYPSLYYPEMYILKGGYKEFFPQHPNFCEPQDYRPMNHEAF KDELKTFRLKTRSWAGERSRRELCSRLQDQ
    • Molecular weight
      110 kDa including tags
    • Amino acids
      1 to 580

Specifications

Our Abpromise guarantee covers the use of ab105906 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    The Specific activity of ab105906 was determined to be 21 nmol/min/mg.
  • Applications

    Western blot

    Functional Studies

  • Purity
    > 70 % Densitometry.
    Purity was determined to be >70% by densitometry.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 25% Glycerol, 50mM Tris HCl, 150mM Sodium chloride, 10mM Glutathione, 0.25mM DTT, 0.1mM EDTA, 0.1mM PMSF, pH 7.5

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • AI604853
    • Cdc 25B
    • Cdc25b
    • CDC25HU2
    • Cdc25m2
    • Cell division cycle 25 homolog B
    • Cell division cycle 25B
    • Cell division cycle 25B isoform 1
    • Cell division cycle 25B isoform 2
    • Cell division cycle 25B isoform 3
    • Cell division cycle 25B isoform 4
    • Cell division cycle 25B isoform 5
    • Dual specificity phosphatase Cdc25B
    • EC 3.1.3.48
    • M phase inducer phosphatase 2
    • M-phase inducer phosphatase 2
    • MPIP2_HUMAN
    see all
  • Function
    Tyrosine protein phosphatase which functions as a dosage-dependent inducer of mitotic progression. Required for G2/M phases of the cell cycle progression and abscission during cytokinesis in a ECT2-dependent manner. Directly dephosphorylates CDK1 and stimulates its kinase activity. The three isoforms seem to have a different level of activity.
  • Sequence similarities
    Belongs to the MPI phosphatase family.
    Contains 1 rhodanese domain.
  • Post-translational
    modifications
    Phosphorylated by BRSK1 in vitro. Phosphorylated by CHEK1, which inhibits the activity of this protein. Phosphorylation at Ser-353 by AURKA might locally participate in the control of the onset of mitosis. Phosphorylation by MELK at Ser-169 promotes localization to the centrosome and the spindle poles during mitosis. Phosphorylation at Ser-323 and Ser-375 by MAPK14 is required for binding to 14-3-3 proteins.
  • Cellular localization
    Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton, spindle pole.
  • Information by UniProt

Images

  • The Specific activity of ab105906 was determined to be 21 nmol/min/mg.
  • SDS-PAGE showing ab105906 at approximately 110kDa.
  • Anti-Cdc25B antibody (ab70927) at 1/100 dilution + Recombinant human Cdc25B protein (ab105906) at 0.01 µg

    Secondary
    Goat Anti-Rabbit IgG H&L (HRP) preadsorbed (ab97080) at 1/5000 dilution
    Developed using the ECL technique

    Performed under reducing conditions.

    Exposure time : 10 seconds

References

ab105906 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab105906.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up