Recombinant Human Cdc25B protein (ab158075)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VRFWKAGVGALREEEGACWGGSLACEDPPLPSWLQDGFVFKMPWKPTHPS STHALAEWASRREAFAQRPSSAPDLMCLSPDRKMEVEELSPLALGRFSLT
    • Amino acids
      181 to 280
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158075 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AI604853
    • Cdc 25B
    • Cdc25b
    • CDC25HU2
    • Cdc25m2
    • Cell division cycle 25 homolog B
    • Cell division cycle 25B
    • Cell division cycle 25B isoform 1
    • Cell division cycle 25B isoform 2
    • Cell division cycle 25B isoform 3
    • Cell division cycle 25B isoform 4
    • Cell division cycle 25B isoform 5
    • Dual specificity phosphatase Cdc25B
    • EC 3.1.3.48
    • M phase inducer phosphatase 2
    • M-phase inducer phosphatase 2
    • MPIP2_HUMAN
    see all
  • Function
    Tyrosine protein phosphatase which functions as a dosage-dependent inducer of mitotic progression. Required for G2/M phases of the cell cycle progression and abscission during cytokinesis in a ECT2-dependent manner. Directly dephosphorylates CDK1 and stimulates its kinase activity. The three isoforms seem to have a different level of activity.
  • Sequence similarities
    Belongs to the MPI phosphatase family.
    Contains 1 rhodanese domain.
  • Post-translational
    modifications
    Phosphorylated by BRSK1 in vitro. Phosphorylated by CHEK1, which inhibits the activity of this protein. Phosphorylation at Ser-353 by AURKA might locally participate in the control of the onset of mitosis. Phosphorylation by MELK at Ser-169 promotes localization to the centrosome and the spindle poles during mitosis. Phosphorylation at Ser-323 and Ser-375 by MAPK14 is required for binding to 14-3-3 proteins.
  • Cellular localization
    Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton, spindle pole.
  • Information by UniProt

Images

  • ab158075 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158075 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158075.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up