Recombinant Human Cdc26 / Apc12 protein (ab108123)

Overview

  • Product nameRecombinant Human Cdc26 / Apc12 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ8NHZ8
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMLRRKPTRLELKLDDIEEFENIRKDLETRK KQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQPKPNNRSSQF GSLEF
    • Molecular weight12 kDa including tags
    • Amino acids1 to 85
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab108123 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab108123 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 40% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • ANAPC12
    • Anaphase promoting complex subunit 12
    • Anaphase promoting complex subunit CDC26
    • APC12
    • BWK 2
    • C9orf17
    • Cdc26
    • CDC26 subunit of anaphase promoting complex
    • Cell division cycle 26
    • Cell division cycle 26 homolog (S. cerevisiae)
    • Cell division cycle protein 26 homolog
    • Chromosome 9 open reading frame 17
    • Hcn1
    • OTTMUSP00000015243
    • OTTMUSP00000015244
    • Protein BWK 2
    see all
  • RelevanceThe protein encoded by this gene is highly similar to Saccharomyces cerevisiae Cdc26, a component of cell cycle anaphase-promoting complex (APC). APC is composed of a group of highly conserved proteins and functions as a cell cycle-regulated ubiquitin-protein ligase. APC thus is responsible for the cell cycle regulated proteolysis of various proteins.
  • Cellular localizationNuclear

Recombinant Human Cdc26 / Apc12 protein images

  • 15% SDS-PAGE analysis of 3µg ab108123.

References for Recombinant Human Cdc26 / Apc12 protein (ab108123)

ab108123 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab108123.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"