Recombinant Human CDC2L1 protein (ab158070)

Overview

  • Product name
    Recombinant Human CDC2L1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KRFGALLSDQGFDLMNKFLTYFPGRRISAEDGLKHEYFRETPLPIDPSMF PTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDLKETGFHLTTTNQGAS AAGPGFSLKF
    • Amino acids
      686 to 795
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158070 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CDC related protein kinase p58
    • CDC2L2
    • Cdk11
    • Cell division cycle 2 like 1
    • PITSLRE serine/threonine protein kinase CDC2L1
    • PITSLREA
    • PK58
    see all
  • Relevance
    CDC2L1 is part of the Ser/Thr protein kinase family and CDC2/CDKX subfamily. CDC2L1 is involved in cell cycle progression, cytokinesis and apoptosis. Phosphorylation at Thr-448 or Tyr-449 inactivates the enzyme, while phosphorylation at Thr-595 activates it. There are several named isoforms that arise from alternative splicing. The p110 isoforms have been suggested to be involved in pre-mRNA splicing, potentially by phosphorylating the splicing protein SFRS7. The p58 isoform may act as a negative regulator of normal cell cycle progression. The cleaved p110 isoform, p110C, binds to the serine/threonine kinase PAK1, and to RANBP9. The p58 isoform but not the p110 isoforms or p110C interacts with CCND3. The p110 isoforms are found in large molecular weight complexes containing CCNL1 and SFRS7. CDC2L1 is expressed ubiquitously and there is some evidence of isoform-specific tissue distribution. The p58 isoform is specifically induced in G2/M phase of the cell cycle. During apoptosis, induced by Fas or tumor necrosis factor, specific PITSLRE p110 isoforms are cleaved by caspases to produce a protein (p110C) that contains the C-terminal kinase domain of the PITSLRE proteins.
  • Cellular localization
    Cytoplasmic and Nuclear

Images

  • ab158070 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158070 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158070.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up