Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ16543
    • SpeciesHuman
    • SequenceMKHHHHHHASMVDYSVWDHIEVSDDEDETHPNIDTASLFRWRHQARVERM EQFQKEKEELDRGCRECKRKVAECQRKLKELEVAEGGKAELERLQAEAQQ LRKEERSWEQKLEEMRKKEKSMPWNVDTLSKDGFSKSMVNTKPEKTEEDS EEVREQKHKTFVEKYEKQIKHFGMLRRWDDSQKYLSDNVHLVCEETANYL VIWCIDLEVEEKCALMEQVAHQTIVMQFILELAKSLKVDPRACFRQFFTK IKTADRQYMEGFNDELEAFKERVRGRAKLRIEKAMKEYEEEERKKRLGPG GLDPVEVYESLPEELQKCFDVKDVQMLQDAISKMDPTDAKYHMQRCIDSG LWVPNSKASEAKEGEEAGPGDPLLEAVPKTGDEKDVSV
    • Molecular weight46 kDa including tags
    • Amino acids1 to 378
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101118 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

  • FormLyophilised
  • Additional notesStore lyophilized protein at –20°C. Lyophilized protein is unstable at 4°C and at RT. Lyophilized protein remains stable until the expiry date when stored at –20°C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80°C for long term storage. Reconstituted protein can be stored at 4°C for a limited period of time unlike the lyophilized protein; it does not show any change after one week at 4°C. If not stored at –20°C the protein must be reconstituted to remain stable.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 50mM Sodium chloride, 20mM Tris, pH 7.5

  • ReconstitutionAdd deionized water to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely. Product is not sterile! Please filter the product by an appropriate sterile filter before using it in the cell culture.

General Info

  • Alternative names
    • CDC 37
    • Cdc37
    • CDC37 cell division cycle 37 homolog
    • CDC37 cell division cycle 37 S cerevisiae homolog
    • CDC37 cell division cycle 37, S cerevisiae, homolog of
    • Cdc37 homolog
    • CDC37 protein
    • CDC37_HUMAN
    • CDC37A
    • cell division cycle 37
    • Cell division cycle 37 homolog
    • Hsp90 chaperone protein kinase targeting subunit
    • Hsp90 chaperone protein kinase targeting subunit p50Cdc37
    • Hsp90 chaperone protein kinase-targeting subunit
    • Hsp90 co chaperone Cdc37
    • Hsp90 co-chaperone Cdc37
    • p50
    • p50Cdc37
    • S cerevisiae hypothetical protein CDC37
    see all
  • FunctionCo-chaperone that binds to numerous kinases and promotes their interaction with the Hsp90 complex, resulting in stabilization and promotion of their activity.
  • Sequence similaritiesBelongs to the CDC37 family.
  • Post-translational
    modifications
    Constitutively sumoylated by UBE2I.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human Cdc37 protein images

  • 14% SDS-PAGE analysis of ab101118
    Lane 1: Molecular weight markers 14, 21, 31, 45, 66, 97 kDa
    Lane 2: ab101118 (reduced and heated, 5µg/lane)
    Lane 3: ab101118 (non-reduced and non-heated, 5µg/lane)

References for Recombinant Human Cdc37 protein (ab101118)

ab101118 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101118.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"