Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSAAIAALAASYGSGSGSESDSDSESSRCPLPAADSLMHLTKSPSSKPSL AVAVDSAPEVAVKEDLETGVHLDPAVKEVQYNPTYETMFAPEFGPENPFR TQQMAAPRNMLSGYAEPAHINDFMFEQQRRTFATYGYALDPSLDNHQVSA KYIGSVEEAEKNQGLTVFETGQKKTEKRKKFKENDASNIDGFLGPWAKYV DEKDVAKPSEEEQKELDEITAKRQKKGKQEEEKPGEEKTILHVKEMYDYQ GRSYLHIPQDVGVNLRSTMPPEKCYLPKKQIHVWSGHTKGVSAVRLFPLS GHLLLSCSMDCKIKLWEVYGERRCLRTFIGHSKAVRDICFNTAGTQFLSA AYDRYLKLWDTETGQCISRFTNRKVPYCVKFNPDEDKQNLFVAGMSDKKI VQWDIRSGEIVQEYDRHLGAVNTIVFVDENRRFVSTSDDKSLRVWEWDIP VDFKYIAEPSMHSMPAVTLSPNGKWLACQSMDNQILIFGAQNRFRLNKKK IFKGHMVAGYACQVDFSPDMSYVISGDGNGKLNIWDWKTTKLYSRFKAHD KVCIGAVWHPHETSKVITCGWDGLIKLWD
    • Amino acids
      1 to 579
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162521 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cdc40
    • Cell division cycle 40
    • Cell division cycle 40 homolog
    • EH binding protein 3
    • EH-binding protein 3
    • Ehb3
    • hPRP17
    • Pre mRNA processing factor 17
    • Pre mRNA splicing factor 17
    • Pre-mRNA-processing factor 17
    • PRP17
    • PRP17 homolog
    • PRP17_HUMAN
    • PRPF17
    see all
  • Function
    Associates with the spliceosome late in the splicing pathway and may function in the second step of pre-mRNA splicing.
  • Sequence similarities
    Contains 7 WD repeats.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab162521 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162521 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162521.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up