Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ISQVISEVDGNRMTLSQEGAQDSFPLQQKILVCSLMLLIRQLKIKEVTLG KLYEAYSKVCRKQQVAAVDQSECLSLSGLLEARGILGLKRNKETRLTKVF
    • Amino acids
      434 to 533
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152271 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cdc 18L
    • Cdc 6
    • CDC18 (cell division cycle 18, S.pombe, homolog) like
    • CDC18 (S.pombe)
    • Cdc18 related protein
    • CDC18(S.pombe)
    • Cdc18-related protein
    • Cdc18L
    • cdc6
    • CDC6 cell division cycle 6 homolog
    • CDC6 related protein
    • CDC6-related protein
    • CDC6_HUMAN
    • Cdc6p
    • CELL CYCLE CONTROLLER CDC6
    • Cell division control protein 6
    • Cell division control protein 6 homolog
    • Cell division cycle 6 homolog
    • Cell division cycle 6 homolog (S. cerevisiae)
    • Cell division cycle 6, S. cerevisiae, homolog of
    • HsCDC 6
    • HsCDC18
    • HsCDC6
    • p62
    • p62(cdc 6)
    • p62(cdc6)
    see all
  • Function
    Involved in the initiation of DNA replication. Also participates in checkpoint controls that ensure DNA replication is completed before mitosis is initiated.
  • Sequence similarities
    Belongs to the CDC6/cdc18 family.
  • Cellular localization
    Nucleus. Cytoplasm. The protein is nuclear in G1 and cytoplasmic in S-phase cells.
  • Information by UniProt

Images

  • ab152271 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152271 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152271.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up