Recombinant Human Cdc7 Kinase protein (ab159989)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      QGTHDTKIELLKFVQSEAQQERCSQNKSHIITGNKIPLSGPVPKELDQQS TTKASVKRPYTNAQIQIKQGKDGKEGSVGLSVQRSVFGERNFNIHSSISH
    • Amino acids
      201 to 300
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159989 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cdc 7
    • CDC7
    • CDC7 cell division cycle 7
    • CDC7 cell division cycle 7 like 1
    • CDC7 L1
    • Cdc7 like 1
    • CDC7 related kinase
    • CDC7-related kinase
    • CDC7_HUMAN
    • CDC7L 1
    • CDC7L1
    • Cell division cycle 7 homolog
    • Cell division cycle 7 kinase
    • Cell division cycle 7 like protein 1
    • Cell division cycle 7 related protein kinase
    • Cell division cycle 7-related protein kinase
    • HsCDC 7
    • HsCdc7
    • Hsk 1
    • Hsk1
    • HuCDC 7
    • huCdc7
    • MGC117361
    • MGC126237
    • MGC126238
    see all
  • Function
    Seems to phosphorylate critical substrates that regulate the G1/S phase transition and/or DNA replication. Can phosphorylates MCM2 and MCM3.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. CDC7 subfamily.
    Contains 1 protein kinase domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab159989 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159989 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159989.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up