Overview

  • Product name
    Recombinant Human CDCA4 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MFARGLKRKCVGHEEDVEGALAGLKTVSSYSLQRQSLLDMSLVKLQLCHM LVEPNLCRSVLIANTVRQIQEEMTQDGTWRTVAPQAAERAPLDRLVSTEI LCRAAWGQEGAHPAPGLGDGHTQGPVSDLCPVTSAQAPRHLQSSAWEMDG PRENRGSFHKSLDQIFETLETKNPSCMEELFSDVDSPYYDLDTVLTGMMG GARPGPCEGLEGLAPATPGPSSSCKSDLGELDHVVEILVET
    • Amino acids
      1 to 241
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162941 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CDCA 4
    • Cdca4
    • CDCA4_HUMAN
    • Cell division cycle associated 4
    • Cell division cycle-associated protein 4
    • FLJ20764
    • FLJ52878
    • Hematopoietic progenitor protein
    • Hepp
    • MGC19517
    • SEI 3
    • SEI-3/HEPP
    • SEI3
    see all
  • Function
    May participate in the regulation of cell proliferation through the E2F/RB pathway. May be involved in molecular regulation of hematopoietic stem cells and progenitor cell lineage commitment and differentiation.
  • Tissue specificity
    Highest levels of expression in the pancreas, thymus, testis, spleen, liver, placenta and leukocytes. Relatively low levels in the lung, kidney, prostate, ovary, small intestine and colon. Hardly detectable, if at all, in the brain, skeletal muscle and heart.
  • Sequence similarities
    Contains 1 SERTA domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab162941 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162941 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162941.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up