Recombinant Human CDIPT1 protein (ab160982)

Overview

  • Product name
    Recombinant Human CDIPT1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPDENIFLFVPNLIGYARIVFAIISFYFMPCCPLTASSFYLLSGLLDAFD GHAARALNQGTRFGAMLDMLTDRCSTMCLLVNLALLYPGATLFFQISMSL DVASHWLHLHSSVVRGSESHKMIDLSGNPVLRIYYTSRPALFTLCAGNEL FYCLLYLFHFSEGPLVGSVGLFRMGLWVTAPIALLKSLISVIHLITAARN MAALDAADRAKKK
    • Amino acids
      1 to 213
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160982 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CDP diacylglycerol inositol 3 phosphatidyltransferase
    • CDP diacylglycerol inositol 3 phosphatidyltransferase (phosphatidylinositol synthase)
    • MGC1328
    • Phosphatidylinositol synthase
    • PIS
    • PIS1
    • PtdIns synthase
    see all
  • Relevance
    Phosphatidylinositol breakdown products are ubiquitous second messengers that function downstream of many G protein-coupled receptors and tyrosine kinases regulating cell growth, calcium metabolism, and protein kinase C activity. Two enzymes, CDP-diacylglycerol synthase and phosphatidylinositol synthase, are involved in the biosynthesis of phosphatidylinositol. Phosphatidylinositol synthase, a member of the CDP-alcohol phosphatidyl transferase class-I family, is an integral membrane protein found on the cytoplasmic side of the endoplasmic reticulum and the Golgi apparatus.
  • Cellular localization
    Endoplasmic reticulum membrane; Multi-pass membrane protein By similarity. Golgi apparatus membrane; Multi-pass membrane protein By similarity. Cell membrane; Multi-pass membrane protein

Images

  • ab160982 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160982 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160982.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up