Overview

Description

  • NatureRecombinant
  • SourceBaculovirus infected Sf9 cells
  • Amino Acid Sequence
    • AccessionP06493
    • SpeciesHuman
    • SequenceMEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIR EISLLKELRH PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQ YMDSSLVKSYLYQILQGIVFCH SRRVLHRDLKPQNLLIDDKGTIKLAD FGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR YSTPVDIWSIGTIF AELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT FP KWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDN QIKKM
    • Amino acids1 to 297
    • TagsGST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab64306 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • FormLiquid
  • Additional notesThis protein is inactive. CDK1 is activated by its counterpart Cyclin (eg. Cyclin A). Since CDK1 is not expressed with Cyclin, the protein is inactive
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 25% Glycerol, 50mM Sodium chloride, 50mM Tris HCl, 0.25mM DTT, 0.1mM EDTA, 0.1mM PMSF, pH 7.5

General Info

  • Alternative names
    • Cdc 2
    • Cdc2
    • CDC28A
    • CDK 1
    • CDK1
    • CDK1_HUMAN
    • CDKN1
    • CELL CYCLE CONTROLLER CDC2
    • Cell division control protein 2
    • Cell division control protein 2 homolog
    • Cell division cycle 2 G1 to S and G2 to M
    • Cell division protein kinase 1
    • Cell Divsion Cycle 2 Protein
    • Cyclin Dependent Kinase 1
    • Cyclin-dependent kinase 1
    • DKFZp686L20222
    • MGC111195
    • p34 Cdk1
    • p34 protein kinase
    • P34CDC2
    see all
  • FunctionPlays a key role in the control of the eukaryotic cell cycle. It is required in higher cells for entry into S-phase and mitosis. p34 is a component of the kinase complex that phosphorylates the repetitive C-terminus of RNA polymerase II.
  • Tissue specificityIsoform 2 is found in breast cancer tissues.
  • Sequence similaritiesBelongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.
    Contains 1 protein kinase domain.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human CDK1 protein images

  • ab64306 on SDS-PAGE, MW 58kDa.

References for Recombinant Human CDK1 protein (ab64306)

ab64306 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab64306.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"