Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIR EISLLKELRH PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQ YMDSSLVKSYLYQILQGIVFCH SRRVLHRDLKPQNLLIDDKGTIKLAD FGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR YSTPVDIWSIGTIF AELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT FP KWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDN QIKKM
    • Amino acids
      1 to 297
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab64306 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    This protein is inactive. CDK1 is activated by its counterpart Cyclin (eg. Cyclin A). Since CDK1 is not expressed with Cyclin, the protein is inactive
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 25% Glycerol, 50mM Sodium chloride, 50mM Tris HCl, 0.25mM DTT, 0.1mM EDTA, 0.1mM PMSF, pH 7.5

General Info

  • Alternative names
    • Cdc 2
    • Cdc2
    • CDC28A
    • CDK 1
    • CDK1
    • CDK1_HUMAN
    • CDKN1
    • CELL CYCLE CONTROLLER CDC2
    • Cell division control protein 2
    • Cell division control protein 2 homolog
    • Cell division cycle 2 G1 to S and G2 to M
    • Cell division protein kinase 1
    • Cell Divsion Cycle 2 Protein
    • Cyclin Dependent Kinase 1
    • Cyclin-dependent kinase 1
    • DKFZp686L20222
    • MGC111195
    • p34 Cdk1
    • p34 protein kinase
    • P34CDC2
    see all
  • Function
    Plays a key role in the control of the eukaryotic cell cycle. It is required in higher cells for entry into S-phase and mitosis. p34 is a component of the kinase complex that phosphorylates the repetitive C-terminus of RNA polymerase II.
  • Tissue specificity
    Isoform 2 is found in breast cancer tissues.
  • Sequence similarities
    Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.
    Contains 1 protein kinase domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab64306 on SDS-PAGE, MW 58kDa.

References

ab64306 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab64306.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up