Recombinant Human CDK11B protein (ab177571)

Overview

  • Product name
    Recombinant Human CDK11B protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGDEKDSWKVKTLDEILQEKKRRKEQEEKAEIKRLKNSDDRDSKRDSLEE GELRDHRMEITIRNSPYRREDSMEDRGEEDDSLAIKPPQQMSRKEKVHHR KDEKRKEKRRHRSHSAEGGKHARVKEKEREHERRKRHREEQDKARREWER QKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEE RRKEREARREVSAHHRTMREDYSDKVKASHWSRSPPRPPRERFELGDGRK PGEARPARAQKPAQLKEEKMEERDLLSDLQDISDSERKTSSAESSSAESG SGSEEEEEEEEEEEEEGSTSEESEEEEEEEEEEEEETGSNSEEASEQSAE EVSEEEMSEDEERENENHLLVVPESRFDRDSGESEEAEEEVGEGTPQSSA LTEGDYVPDSPALSPIELKQELPKYLPALQGCRSVEEFQCLNRIEEGTYG VVYRAKDKKTDEIVALKRLKMEKEKEGFPITSLREINTILKAQHPNIVTV REIVVGSNMDKIYIVMNYVEHDLKSLMETMKQPFLPGEVKTLMIQLLRGV KHLHDNWILHRDLKTSNLLLSHAGILKVGDFGLAREYGSPLKAYTPVVVT LWYRAPELLLGAKEYSTAVDMWSVGCIFGELLTQKPLFPGKSEIDQINKV FKDLGTPSEKIWPGYSELPAVKKMTFSEHPYNNLRKRFGALLSDQGFDLM NKFLTYFPGRRISAEDGLKHEYFRETPLPIDPSMFPTWPAKSEQQRVKRG TSPRPPEGGLGYSQLGDDDLKETGFHLTTTNQGASAAGPGFSLKF
    • Molecular weight
      135 kDa including tags
    • Amino acids
      1 to 795
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab177571 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 70 % Densitometry.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    Information available upon request.

General Info

  • Alternative names
    • CDC2L1
    • CDK11
    • Cell division cycle 2-like protein kinase 1
    • Cell division protein kinase 11B
    • CLK 1
    • EC=2.7.11.22
    • Galactosyltransferase associated protein kinase p58/GTA
    • ITSLRE serine/threonine protein kinase CDC2L1
    • p58 CLK 1
    • PITSLREA
    • PK58
    see all
  • Relevance
    Appears to play multiple roles in cell cycle progression, cytokinesis and apoptosis. The p110 isoforms have been suggested to be involved in pre-mRNA splicing, potentially by phosphorylating the splicing protein SFRS7. The p58 isoform may act as a negative regulator of normal cell cycle progression.
  • Cellular localization
    Cytoplasmic and Nuclear

Images

  • SDS-PAGE analysis of ab177571.

References

ab177571 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177571.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up