Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP24941
    • SpeciesHuman
    • SequenceMENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIR EISLLKELNHPNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIP LPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLAR AFGVPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRR ALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSK VVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRLLE HHHHHH
    • Molecular weight35 kDa including tags
    • Amino acids1 to 198
    • TagsHis tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab111646 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab111646 is purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 20% Glycerol, 0.02% DTT
    Note: Contains 79% Tris-HCl buffer.

General Info

  • Alternative names
    • Cdc2 related protein kinase
    • cdc2-related protein kinase
    • CDC28
    • CDC2A
    • Cdk 2
    • CDK1
    • CDK2
    • CDK2_HUMAN
    • CDKN2
    • Cell devision kinase 2
    • Cell division protein kinase 2
    • Cyclin dependent kinase 2
    • cyclin dependent kinase 2-alpha
    • Cyclin-dependent kinase 2
    • kinase Cdc2
    • MPF
    • p33 protein kinase
    • p33(CDK2)
    see all
  • FunctionInvolved in the control of the cell cycle. Interacts with cyclins A, B1, B3, D, or E. Activity of CDK2 is maximal during S phase and G2.
  • Sequence similaritiesBelongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.
    Contains 1 protein kinase domain.
  • Information by UniProt

Recombinant Human Cdk2 protein images

  • 15% SDS-PAGE analysis of ab111646 (3 µg)

References for Recombinant Human Cdk2 protein (ab111646)

ab111646 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab111646.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"