Recombinant Human Cdk3 protein (ab158082)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      DSEIDQLFRIFRMLGTPSEDTWPGVTQLPDYKGSFPKWTRKGLEEIVPNL EPEGRDLLMQLLQYDPSQRITAKTALAHPYFSSPEPSPAARQYVLQRFRH
    • Amino acids
      206 to 305
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158082 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cdk 3
    • Cdk3
    • CDK3_HUMAN
    • CDKN3
    • Cell division kinase 3
    • Cell division protein kinase 3
    • Cyclin dependent kinase 3
    • Cyclin-dependent kinase 3
    • OTTHUMP00000206828
    • p36
    see all
  • Function
    Probably involved in the control of the cell cycle. Interacts with a yet unknown type of cyclin. Can phosphorylate histone H1.
  • Sequence similarities
    Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.
    Contains 1 protein kinase domain.
  • Information by UniProt

Images

  • ab158082 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158082 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Thank you for contacting us. The peptide sequence is correct. The peptide is tagged with GST, which is ˜26 kD. Ihave attached the pdf of the datasheet to this email, it opened fine for me so let me know if you still have a problem viewing it, or if you...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up