Recombinant Human CDK5RAP1 protein (ab162623)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MHPLQCVLQVQRSLGWGPLASVSWLSLRMCRAHSSLSSTMCPSPERQEDG ARKDFSSRLAAGPTFQHFLKSASAPQEKLSSEVEDPPPYLMMDELLGRQR KVYLETYGCQMNVNDTEIAWSILQKSGYLRTSNLQEADVILLVTCSIREK AEQTIWNRLHQLKALKTRRPRSRVPLRIGILGCMAERLKEEILNREKMVD ILAGPDAYRDLPRLLAVAESGQQAANVLLSLDETYADVMPVQTSASATSA FVSIMRGCDNMCSYCIVPFTRGRERSRPIASILEEVKKLSEQGLKEVTLL GQNVNSFRDNSEVQFNSAVPTNLSRGFTTNYKTKQGGLRFAHLLDQVSRV DPEMRIRFTSPHPKDFPDEVLQLIHERDNICKQIHLPAQSGSSRVLEAMR RGYSREAYVELVHHIRESIPGVSLSSDFIAGFCGETEEDHVQTVSLLREV QYNMGFLFAYSMRQKTRAYHRLKDDVPEEVKLRRLEELITIFREEATKAN QTSVGCTQLVLVEGLSKRSATDLCGRNDGNLKVIFPDAEMEDVNNPGLRV RAQPGDYVLVKITSASSQTLRGHVLCRTTLRDSSAYC
    • Amino acids
      1 to 587
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162623 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2310066P17Rik
    • C20orf34
    • C42
    • CDK5 activator binding protein C42
    • CDK5 activator binding protein C42 like
    • CDK5 regulatory subunit associated protein 1
    • CDK5RAP1.3
    • CDK5RAP1.4
    • CGI 05
    • HSPC167
    • OTTMUSP00000016976
    • RP23-154J12.6
    • RP5-1187J4.1
    see all
  • Relevance
    CDK5RAP1 specifically inhibits CDK5 activation by CDK5R1.
  • Cellular localization
    Cytoplasmic

Images

  • ab162623 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162623 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162623.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up