Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      YPALGLLKGCLHMDPTQRLTCEQLLHHPYFENIREIEDLAKEHNKPTRKT LRKSRKHHCFTETSKLQYLPQLTGSSILPALDNKKYYCDTKKLNYRFPNI
    • Amino acids
      259 to 358
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160206 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CDC 2 related kinase
    • CDC 2 related kinase 1
    • CDC2 related kinase
    • CDC2 related kinase 1
    • CDK L1
    • CDKL 1
    • cdkl1
    • CDKL1_HUMAN
    • Cyclin dependent kinase like 1
    • Cyclin-dependent kinase-like 1
    • cyclin-dependent kinase-like 1 (CDC2-related kinase)
    • EC 2.7.11.22
    • KKIALRE
    • p42
    • Protein kinase p42 KKIALRE
    • Serine/threonine protein kinase KKIALRE
    • Serine/threonine-protein kinase KKIALRE
    see all
  • Tissue specificity
    Highly expressed in kidney, and to a lower extent in ovary.
  • Sequence similarities
    Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.
    Contains 1 protein kinase domain.
  • Domain
    The [NKR]KIAxRE motif seems to be a cyclin-binding region.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • ab160206 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160206 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160206.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up