Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MEKYENLGLVGEGSYGMVMKCRNKDTGRIVAIKKFLESDDDKMVKKIAMR EIKLLKQLRHENLVNLLEVCKKKKRWYLVFEFVDHTILDDLELFPNGLDY QVVQKYLFQIINGIGFCHSHNIIHRDIKPENILVSQSGVVKLCDFGFART LAAPGEVYTDYVATRWYRAPELLVGDVKYGKAVDVWAIGCLVTEMFMGEP LFPGDSDIDQLYHIMMCLGNLIPRHQELFNKNPVFAGVRLPEIKEREPLE RRYPKLSEVVIDLAKKCLHIDPDKRPFCAELLHHDFFQMDGFAERFSQEL QLKVQKDARNVSLSKKSQNRKKEKEKDDSLVEERKTLVVQDTNADPKIKD YKLFKIKGSKIDGEKAEKGNRASNASCLHDSRTSHNKIVPSTSLKDCSNV SVDHTRNPSVAIPPLTHNLSAVAPSINSGMGTETIPIQGYRVDEKTKKCS IPFVKPNRHSPSGIYNINVTTLVSGPPLSDDSGADLPQMEHQH
    • Molecular weight
      81 kDa including tags
    • Amino acids
      1 to 493
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab167948 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

  • Purity
    > 80 % Densitometry.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.50
    Constituents: 0.31% Glutathione, 0.002% PMSF, 0.004% DTT, 0.79% Tris HCl, 0.004% EDTA, 25% Glycerol, 0.29% Sodium chloride

General Info

  • Alternative names
    • CDC2 related kinase
    • CDK L2
    • CDKL 2
    • CDKL2
    • CDKL2_HUMAN
    • Cyclin dependent kinase like 2
    • Cyclin-dependent kinase-like 2
    • KKIAMRE
    • p56 KKIAMRE protein kinase
    • Protein kinase p56 KKIAMRE
    • Serine/threonine protein kinase KKIAMRE
    • Serine/threonine-protein kinase KKIAMRE
    see all
  • Tissue specificity
    Expressed in testis and kidney, and at lower level in brain and lung.
  • Sequence similarities
    Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.
    Contains 1 protein kinase domain.
  • Domain
    The [NKR]KIAxRE motif seems to be a cyclin-binding region.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab167948.

References

ab167948 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167948.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up