Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MEKYEKLAKTGEGSYGVVFKCRNKTSGQVVAVKKFVESEDDPVVKKIALR EIRMLKQLKHPNLVNLIEVFRRKRKMHLVFEYCDHTLLNELERNPNGVAD GVIKSVLWQTLQALNFCHIHNCIHRDIKPENILITKQGIIKICDFGFAQI LIPGDAYTDYVATRWYRAPELLVGDTQYGSSVDIWAIGCVFAELLTGQPL WPGKSDVDQLYLIIRTLGKLIPRHQSIFKSNGFFHGISIPEPEDMETLEE KFSDVHPVALNFMKGCLKMNPDDRLTCSQLLESSYFDSFQEAQIKRKARN EGRNRRRQQVLPLKS
    • Molecular weight
      60 kDa including tags
    • Amino acids
      1 to 315
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab167967 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

  • Purity
    >90% by SDS-PAGE.
    Assessed by densitometry.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.50
    Constituents: 0.31% Glutathione, 0.002% PMSF, 0.004% DTT, 0.79% Tris HCl, 0.003% EDTA, 25% Glycerol, 0.29% Sodium chloride

General Info

  • Alternative names
    • CDKL4
    • CDKL4_HUMAN
    • Cyclin dependent kinase like 4
    • Cyclin-dependent kinase-like 4
    • EC 2.7.11.22
    • OTTHUMP00000164944
    see all
  • Sequence similarities
    Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.
    Contains 1 protein kinase domain.
  • Domain
    The [NKR]KIAxRE motif seems to be a cyclin-binding region.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • SDS Page analysis of ab167967

References

ab167967 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167967.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up