Recombinant Human CDKN2AIP protein (ab163139)

Overview

  • Product name
    Recombinant Human CDKN2AIP protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAQEVSEYLSQNPRVAAWVEALRCDGETDKHWRHRRDFLLRNAGDLAPAG GAASASTDEAADAESGTRNRQLQQLISFSMAWANHVFLGCRYPQKVMDKI LSMAEGIKVTDAPTYTTRDELVAKVKKRGISSSNEGVEEPSKKRVIEGKN SSAVEQDHAKTSAKTERASAQQENSSTCIGSAIKSESGNSARSSGISSQN SSTSDGDRSVSSQSSSSVSSQVTTAGSGKASEAEAPDKHGSSFVSLLKSS VNSHMTQSTDSRQQSGSPKKSALEGSSASASQSSSEIEVPLLGSSGSSEV ELPLLSSKPSSETASSGLTSKTSSEASVSSSVAKNSSSSGTSLLTPKSSS STNTSLLTSKSTSQVAASLLASKSSSQTSGSLVSKSTSLASVSQLASKSS SQTSTSQLPSKSTSQSSESSVKFSCKLTNEDVKQKQPFFNRLYKTVAWKL VAVGGFSPNVNHGELLNAAIEALKATLDVFFVPLKELADLPQNKSSQESI VCELRCKSVYLGTGCGKSKENAKAVASREALKLFLKKKVVVKICKRKYRG SEIEDLVLLDEESRPVNLPPALKHPQELL
    • Amino acids
      1 to 579
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163139 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Calcium response factor
    • CARF
    • CARF_HUMAN
    • CDKN2A interacting protein
    • CDKN2A-interacting protein
    • Cdkn2aip
    • collaborates/cooperates with ARF (alternate reading frame) protein
    • Collaborator of ARF
    • FLJ20036
    see all
  • Function
    Activates p53/TP53 by CDKN2A-dependent and CDKN2A-independent pathways.
  • Tissue specificity
    Ubiquitously expressed.
  • Sequence similarities
    Belongs to the CARF family.
    Contains 1 DRBM (double-stranded RNA-binding) domain.
  • Post-translational
    modifications
    May be ubiquitinated.
  • Cellular localization
    Nucleus > nucleoplasm.
  • Information by UniProt

Images

  • ab163139 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163139 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163139.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up