Recombinant Human CDON / Cdo protein (ab162378)

Overview

  • Product name
    Recombinant Human CDON / Cdo protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VKVPVCLTSAVPDCGQLPEESVKDNVEPVPTQRTCCQDIVNDVSSDGSED PAEFSRGDSCAHSETEINIVSWNALILPPVPEGCAEKTMWSPPGIPLDSP TEVLQQPRE
    • Amino acids
      1155 to 1263
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162378 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CDO
    • Cdon
    • CDON_HUMAN
    • Cell adhesion molecule-related/down-regulated by oncogenes
  • Function
    Component of a cell-surface receptor complex that mediates cell-cell interactions between muscle precursor cells. Promotes differentiation of myogenic cells.
  • Involvement in disease
    Holoprosencephaly 11
  • Sequence similarities
    Contains 3 fibronectin type-III domains.
    Contains 5 Ig-like C2-type (immunoglobulin-like) domains.
  • Post-translational
    modifications
    N-glycosylated.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab162378 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162378 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162378.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up