Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ01850
    • SpeciesHuman
    • SequenceMLAENLVEEFEMKEDEPWYDHQDLQQDLQLAAELGKTLLDRNTELEDSVQ QMYTTNQEQLQEIEYLTKQVELLRQMNEQHAKVYEQLDVTARELEETNQK LVADSKASQQKILSLTETIECLQTNIDHLQSQVEELKSSGQGRRSPGKCD QEKPAPSFACLKELYDLRQHFVYDHVFAEKITSLQGQPSPDEEENEHLKK TVTMLQAQLSLERQKRVTMEEEYGLVLKENSELEQQLGATGAYRARALEL EAEVAEMRQMLQSEHPFVNGVEKLVPDSLYVPFKEPSQSLLEEMFLTVPE SHRKPLKRSSSETILSSLAGSDIVKGHEETCIRRAKAVKQRGISLLHEVD TQYSALKVKYEELLKKCQEEQDSLSHKAVQTSRAAAKDLTGVNAQSEPVA SGWELASVNPEPVSSPTTPPEYKALFKEIFSCIKKTKQEIDEQRTKYRSL SSHS
    • Molecular weight76 kDa including tags
    • Amino acids1 to 454

Specifications

Our Abpromise guarantee covers the use of ab116761 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • AA617262
    • CDR 2
    • CDR 62
    • CDR2
    • CDR2_HUMAN
    • CDR62
    • Cerebellar degeneration related protein
    • Cerebellar degeneration related protein 2
    • Cerebellar degeneration related protein 2 62kDa
    • Cerebellar degeneration-related protein 2
    • Major Yo paraneoplastic antigen
    • MGC116181
    • MGC144810
    • MGC144811
    • Paraneoplastic cerebellar degeneration associated antigen
    • Paraneoplastic cerebellar degeneration-associated antigen
    • PCD 17
    • PCD17
    • RGD1310578
    • Yo
    • Yo paraneoplastic antigen
    see all
  • Sequence similaritiesBelongs to the CDR2 family.
  • Information by UniProt

Recombinant Human CDR2 protein images

  • SDS-PAGE analysis of ab116761 on a 12.5% gel stained with Coomassie Blue.

References for Recombinant Human CDR2 protein (ab116761)

ab116761 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116761.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"