Overview

  • Product nameRecombinant Human Cdx1 protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP47902
    • SpeciesHuman
    • SequenceGAQRPTPYEWMRRSVAAGGGGGSGKTRTKDKYRVVYTDHQRLELEKEFHY SRYITIRRKSELAANLGLTERQVKIWFQNRRAKERKVNKK*
    • Molecular weight36 kDa including tags
    • Amino acids126 to 215

Specifications

Our Abpromise guarantee covers the use of ab114869 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Caudal type homeo box transcription factor 1
    • Caudal type homeobox 1
    • Caudal type homeobox protein
    • Caudal type homeobox protein CDX1
    • Caudal type homeobox transcription factor 1
    • Caudal-type homeobox protein 1
    • CDX1
    • CDX1_HUMAN
    • Homeobox protein CDX 1
    • Homeobox protein CDX-1
    • MGC116915
    • OTTHUMP00000160524
    see all
  • FunctionCould play a role in the terminal differentiation of the intestine.
  • Tissue specificityIntestinal epithelium.
  • Sequence similaritiesBelongs to the Caudal homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human Cdx1 protein images

  • 12.5% SDS-PAGE showing ab114869 at approximately 35.53kDa.
    Stained with Coomassie Blue.

References for Recombinant Human Cdx1 protein (ab114869)

ab114869 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114869.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"