Overview

  • Product name
    Recombinant Human Cdx1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      GAQRPTPYEWMRRSVAAGGGGGSGKTRTKDKYRVVYTDHQRLELEKEFHY SRYITIRRKSELAANLGLTERQVKIWFQNRRAKERKVNKK*
    • Molecular weight
      36 kDa including tags
    • Amino acids
      126 to 215

Specifications

Our Abpromise guarantee covers the use of ab114869 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Caudal type homeo box transcription factor 1
    • Caudal type homeobox 1
    • Caudal type homeobox protein
    • Caudal type homeobox protein CDX1
    • Caudal type homeobox transcription factor 1
    • Caudal-type homeobox protein 1
    • CDX1
    • CDX1_HUMAN
    • Homeobox protein CDX 1
    • Homeobox protein CDX-1
    • MGC116915
    • OTTHUMP00000160524
    see all
  • Function
    Could play a role in the terminal differentiation of the intestine.
  • Tissue specificity
    Intestinal epithelium.
  • Sequence similarities
    Belongs to the Caudal homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114869 at approximately 35.53kDa.
    Stained with Coomassie Blue.

References

ab114869 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114869.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up