Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ99626
    • SpeciesHuman
    • SequenceMYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAA AAANLDSAQSPGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGPNGGS PAAAMGYSSPADYHPHHHPHHHPHHPAAAPSCASGLLQTLNPGPPGPAAT AAAEQLSPGGQRRNLCEWMRKPAQQSLGSQVKTRTKDKYRVVYTDHQRLE LEKEFHYSRYITIRRKAELAATLGLSERQVKIWFQNRRAKERKINKKKLQ QQQQQQPPQPPPPPPQPPQPQPGPLRSVPEPLSPVSSLQASVSGSVPGVL GPTGGVLNPTVTQ
    • Molecular weight61 kDa including tags
    • Amino acids1 to 313

Specifications

Our Abpromise guarantee covers the use of ab114247 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 µg/µl
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Caudal type homeo box 2
    • Caudal type homeo box transcription factor 2
    • Caudal type homeobox 2
    • Caudal type homeobox protein 2
    • Caudal type homeobox transcription factor 2
    • Caudal-type homeobox protein 2
    • CDX 2
    • CDX 3
    • CDX-3
    • Cdx2
    • CDX2_HUMAN
    • CDX3
    • Homeobox protein CDX 2
    • Homeobox protein CDX-2
    see all
  • FunctionInvolved in the transcriptional regulation of multiple genes expressed in the intestinal epithelium. Important in broad range of functions from early differentiation to maintenance of the intestinal epithelial lining of both the small and large intestine.
  • Sequence similaritiesBelongs to the Caudal homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Post-translational
    modifications
    Phosphorylation of Ser-60 mediates the transactivation capacity.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human CDX2 protein images

  • 12.5% SDS-PAGE showing ab114247 at approximately 60.54kDa stained with Coomassie Blue.
  • Anti-CDX2 antibody (ab88129) at 1 µg/ml + Recombinant Human CDX2 protein (ab114247) at 0.01 µg

    Secondary
    Goat Anti-Rabbit IgG H&L (HRP) preadsorbed (ab97080) at 1/5000 dilution
    Developed using the ECL technique

    Performed under reducing conditions.

    Exposure time : 10 seconds

References for Recombinant Human CDX2 protein (ab114247)

ab114247 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114247.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"