Recombinant Human CEACAM6 protein (ab114904)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP40199
    • SpeciesHuman
    • SequencePVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSN GNMTLTLL SVKRNDAGSYECEIQNPASANRSDPVTLNVLY GPDVPTISPSKANYRP GENLNLSCHAASNP
    • Molecular weight38 kDa including tags
    • Amino acids156 to 265

Specifications

Our Abpromise guarantee covers the use of ab114904 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Carcinoembryonic antigen related cell adhesion molecule 6
    • Carcinoembryonic antigen related cell adhesion molecule 6 (non specific cross reacting antigen)
    • Carcinoembryonic antigen-related cell adhesion molecule 6
    • CD 66c
    • CD66c
    • CD66c antigen
    • CEA LIKE PROTEIN
    • CEACAM 6
    • CEACAM6
    • CEAL
    • CEAM6_HUMAN
    • MGC93832
    • NCA
    • Non specific cross reacting antigen
    • Non-specific crossreacting antigen
    • Normal cross reacting antigen
    • Normal cross-reacting antigen
    see all
  • Sequence similaritiesBelongs to the immunoglobulin superfamily. CEA family.
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localizationCell membrane.
  • Information by UniProt

Recombinant Human CEACAM6 protein images

  • 12.5% SDS-PAGE showing ab114904 at approximately 37.73kDa.
    Stained with Coomassie Blue.

References for Recombinant Human CEACAM6 protein (ab114904)

ab114904 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114904.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"