Recombinant Human CEE protein (His tag) (denatured) (ab177608)

Overview

  • Product name
    Recombinant Human CEE protein (His tag) (denatured)
  • Protein length
    Full length protein
  • Description
    Recombinant Human CEE protein (His tag)

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMAAAAAMAEQESARNGGRNRGGVQRVE GKLRASVEKGDYYEAHQMYRTLFFRYMSQSKHTEARELMYSGALLFFSHG QQNSAADLSMLVLESLEKAEVEVADELLENLAKVFSLMDPNSPERVTFVS RALKWSSGGSGKLGHPRLHQLLALTLWKEQNYCESRYHFLHSADGEGCAN MLVEYSTSRGFRSEVDMFVAQAVLQFLCLKNKSSASVVFTTYTQKHPSIE DGPPFVEPLLNFIWFLLLAVDGGKLTVFTVLCEQYQPSLRRDPMYNEYLD RIGQLFFGVPPKQTSSYGGLLGNLLTSLMGSSEQEDGEESPSDGSPIELD
    • Molecular weight
      39 kDa including tags
    • Amino acids
      1 to 327
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab177608 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

General Info

  • Alternative names
    • C7orf20
    • CGI 20
    • CGI20
    • Conserved edge expressed protein
    • Conserved edge protein
    • Conserved edge-expressed protein
    • GET 4
    • GET4
    • GET4_HUMAN
    • Golgi to ER traffic protein 4 homolog
    • Golgi to ER traffic protein 4 homolog (S. cerevisiae)
    • Transmembrane domain recognition complex 35 kDa subunit
    • Transmembrane domain recognition complex 35kDa
    • TRC35
    • UPF0363 protein C7orf20
    see all
  • Function
    Component of the BAT3 complex, a multiprotein complex involved in the post-translational delivery of tail-anchored (TA) membrane proteins to the endoplasmic reticulum membrane. TA membrane proteins, also named type II transmembrane proteins, contain a single C-terminal transmembrane region. The complex acts by facilitating TA proteins capture by ASNA1/TRC40: it is recruited to ribosomes synthesizing membrane proteins, interacts with the transmembrane region of newly released TA proteins, and transfers them to ASNA1/TRC40 for targeting.
  • Sequence similarities
    Belongs to the GET4 family.
  • Cellular localization
    Cytoplasm > cytosol.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab177608 (3 µg).

References

ab177608 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177608.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up