Recombinant Human Cela3b protein (ab161644)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GPPSSRPSSRVVNGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWV VTAGHCISSSWTYQVVLGEYDRAVKEGPEQVIPINSGDLFVHPLWNRSCV ACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNETPCYITGWGRLYTN GPLPDKLQEALLPVVDYEHCSRWNWWGSSVKKTMVCAGGDIRSGCNGDSG GPLNCPTEDGGWQVHGVTSFVSAFGCNTRRKPTVFTRVSAFIDWIEETIA SH
    • Amino acids
      19 to 270
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161644 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CELA3B
    • Chymotrypsin like elastase family member 3B
    • ELA3B
    • Elastase 3B
    • Elastase IIIB
    • Protease E
    see all
  • Relevance
    Function: Efficient protease with alanine specificity but only little elastolytic activity. Tissue specificity: Pancreas. Not detectable in keratinocytes. Similarity: Belongs to the peptidase S1 family. Elastase subfamily. Contains 1 peptidase S1 domain.

Images

  • ab161644 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161644 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161644.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up