Recombinant Human Cellular Apoptosis Susceptibility protein (ab114717)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP55060
    • SpeciesHuman
    • SequenceLIGLFELPEDDTIPDEEHFIDIEDTPGYQTAFSQLAFAGKKEHDPVGQMV NNPKIHLAQSLHKLSTACPGRVPSMVSTSLNAEALQYLQGYLQAASVTLL
    • Molecular weight37 kDa including tags
    • Amino acids872 to 971

Specifications

Our Abpromise guarantee covers the use of ab114717 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CAS
    • Cellular apoptosis susceptibility protein
    • Chromosome segregation 1 (yeast homolog) like
    • Chromosome segregation 1 Like
    • Chromosome segregation 1 like protein
    • Chromosome segregation 1-like protein
    • Chromosome segregation gene CSE1
    • CSE 1
    • CSE 1 chromosome segregation 1 like
    • CSE 1 chromosome segregation 1 like protein
    • CSE 1L
    • CSE1
    • CSE1 chromosome segregation 1 like
    • CSE1 chromosome segregation 1 like (yeast)
    • CSE1 chromosome segregation 1 like protein
    • CSE1L
    • Exp 2
    • Exp2
    • Exportin 2
    • Exportin-2
    • Exportin2
    • Importin alpha re exporter
    • Importin-alpha re-exporter
    • MGC117283
    • MGC130036
    • MGC130037
    • XPO 2
    • XPO2
    • XPO2_HUMAN
    see all
  • FunctionExport receptor for importin-alpha. Mediates importin-alpha re-export from the nucleus to the cytoplasm after import substrates (cargos) have been released into the nucleoplasm. In the nucleus binds cooperatively to importin-alpha and to the GTPase Ran in its active GTP-bound form. Docking of this trimeric complex to the nuclear pore complex (NPC) is mediated through binding to nucleoporins. Upon transit of a nuclear export complex into the cytoplasm, disassembling of the complex and hydrolysis of Ran-GTP to Ran-GDP (induced by RANBP1 and RANGAP1, respectively) cause release of the importin-alpha from the export receptor. CSE1L/XPO2 then return to the nuclear compartment and mediate another round of transport. The directionality of nuclear export is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus.
  • Tissue specificityHighly expressed in proliferating cells.
  • Sequence similaritiesBelongs to the XPO2/CSE1 family.
    Contains 1 importin N-terminal domain.
  • Cellular localizationCytoplasm. Nucleus. Shuttles between the nucleus and the cytoplasm.
  • Information by UniProt

Recombinant Human Cellular Apoptosis Susceptibility protein images

  • 12.5% SDS-PAGE showing ab114717 at approximately 36.63 kDa stained with Coomassie Blue.

References for Recombinant Human Cellular Apoptosis Susceptibility protein (ab114717)

ab114717 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114717.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"