Recombinant Human Cenexin1/ODF2 protein (ab114500)

Overview

  • Product nameRecombinant Human Cenexin1/ODF2 protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ5BUF6
    • SpeciesHuman
    • SequenceKEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDL KDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRSRSPP*
    • Molecular weight37 kDa including tags
    • Amino acids706 to 804

Specifications

Our Abpromise guarantee covers the use of ab114500 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 84 kDa outer dense fiber protein
    • Cancer/testis antigen 134
    • Cenexin
    • Cenexin 1
    • Cenexin1 variant 1
    • CT134
    • FLJ44866
    • KKT 4
    • KKT4
    • MGC111096
    • MGC9034
    • ODF 2
    • ODF 84
    • odf2
    • ODF2/1
    • ODF2/2
    • ODF84
    • ODFP2_HUMAN
    • OTTHUMP00000022274
    • OTTHUMP00000022275
    • Outer dense fiber of sperm tail 2
    • Outer dense fiber of sperm tails 2
    • Outer dense fiber of sperm tails protein 2
    • Outer dense fiber of sperm tails, 84 kD
    • Outer dense fiber protein 2
    • Sperm outer dense fiber major protein 2
    • Sperm tail structural protein
    • Testis specific autoantigen
    see all
  • FunctionSeems to be a major component of sperm tail outer dense fibers (ODF). ODFs are filamentous structures located on the outside of the axoneme in the midpiece and principal piece of the mammalian sperm tail and may help to maintain the passive elastic structures and elastic recoil of the sperm tail. May have a modulating influence on sperm motility. Functions as a general scaffold protein that is specifically localized at the distal/subdistal appendages of mother centrioles. Component of the centrosome matrix required for the localization of PLK1 and NIN to the centrosomes. Required for the formation and/or maintenance of normal CETN1 assembly.
  • Tissue specificityTestis-specific (at protein level). Highly expressed in cytoplasm of step 2 round spermatids. Detected in the middle piece and extends to about half the principal piece of the sperm tails.
  • Sequence similaritiesBelongs to the ODF2 family.
  • Post-translational
    modifications
    Tyrosine phosphorylated.
  • Cellular localizationCytoplasm > cytoskeleton > centrosome. Cell projection > cilium. Cytoplasm > cytoskeleton > centrosome > centriole. Cytoplasm > cytoskeleton > spindle pole. Localized at the microtubule organizing centers in interphase and spindle poles in mitosis. Localized at the distal/subdistal appendages of mother centrioles.
  • Information by UniProt

Recombinant Human Cenexin1/ODF2 protein images

  • ab114500 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References for Recombinant Human Cenexin1/ODF2 protein (ab114500)

ab114500 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114500.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"