Recombinant Human CENPH protein (denatured) (ab113134)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMLNKLIMKSQQESWDLEEKLLDI RKKRL QLKQASESKLLEIQTEKNKQKIDLDSMENSERIKIIRQNLQMEIK ITT VIQHVFQNLILGSKVNWAEDPALKEIVLQLEKNVDMM
    • Molecular weight
      16 kDa including tags
    • Amino acids
      136 to 247
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113134 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 90 % SDS-PAGE.
    ab113134 was denatured using detergent during a conventional chromatography purification process.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names
    • CENP H
    • CENP-H
    • CENPH
    • CENPH_HUMAN
    • Centromere protein H
    • ICEN35
    • Interphase centromere complex protein 35
    • Kinetochore protein CENP H
    • NNF1
    • NNF1, MIND kinetochore complex component, homolog
    • PMF1
    see all
  • Function
    Component of the CENPA-NAC (nucleosome-associated) complex, a complex that plays a central role in assembly of kinetochore proteins, mitotic progression and chromosome segregation. The CENPA-NAC complex recruits the CENPA-CAD (nucleosome distal) complex and may be involved in incorporation of newly synthesized CENPA into centromeres. Required for chromosome congression and efficiently align the chromosomes on a metaphase plate.
  • Sequence similarities
    Belongs to the centromere protein H family.
  • Cellular localization
    Nucleus. Chromosome > centromere > kinetochore. Associates with active centromere-kinetochore complexes throughout the cell cycle. Colocalizes with inner kinetochore plate proteins CENPA and CENPC1 during both interphase and metaphase.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab113134.

References

ab113134 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab113134.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up