Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KPLLFDHLAQLFFTSTIYFKCSVLQSLKELLQNWLLWLSMDIHMKPVTNS PL
    • Amino acids
      471 to 522
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158470 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CENP I
    • centromere protein I
    • Follicle simulating hormone primary response protein
    • FSH primary response 1
    • FSH primary response protein 1
    • FSH primary response, rat, homolog of, 1
    • FSHP1
    • FSHPRH1
    • interphase centromere complex protein 19
    • Leucine rich primary response gene 1
    • Leucine rich primary response protein 1
    • LRPR1
    • Mis6
    see all
  • Relevance
    CENPI is a constitutive protein of the knetochore that shares limited similarity with Mis6 of S. pombe. The kinetochore is a macromolecular complex located at the centromere of chromosomes and provides essential functions for chromosome segregration. CENPI is required for the localization of CENPF and the checkpoint proteins MAD1 and MAD2 to the kinetochore.
  • Cellular localization
    Cytoplasmic and Nuclear

Images

  • ab158470 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158470 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158470.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up