Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSVLRPLDKLPGLNTATILLVGTEDALLQQLADSMLKEDCASELKVHLAK SLPLPSSVNRPRIDLIVFVVNLHSKYSLQNTEESLRHVDASFFLGKVCFL ATGAGRESHCSIHRHTVVKLAHTYQSPLLYCDLEVEGFRATMAQRLVRVL QICAGHVPGVSALNLLSLLRSSEGPSLEDL
    • Amino acids
      1 to 180
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163957 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • bK250D10.2
    • C22orf18
    • CENP M
    • Centromere protein M
    • ICEN 39
    • ICEN39
    • Interphase centromere complex protein 39
    • MGC861
    • OTTHUMP00000028741
    • PANE 1
    • PANE1
    • Proliferation associated nuclear element 1
    • Proliferation associated nuclear element protein 1
    see all
  • Relevance
    CENPM (Centromere protein M) is a component of the CENPA-NAC (nucleosome associated) complex, a complex that plays a central role in kinetochore protein assembly, mitotic cell cycle progression and chromosome segregation.
  • Cellular localization
    Cytoplasmic and Nuclear. Note: Nuclear in non confluent cells and cytoplasmic in confluent or dividing cells. Localizes in the kinetochore domain of centromeres.

Images

  • ab163957 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163957 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163957.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up