Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMSVLRPLDKLPGLNTATILLVGTEDAL LQQLADSMLKEDCASELKVHLAKSLPLPSSVNRPRIDLIVFVVNLHSKYS LQNTEESLRHVDASFFLGKVCFLATGAGRESHCSIHRHTVVKLAHTYQSP LLYCDLEVEGFRATMAQRLVRVLQICAGHVPGVSALNLLSLLRSSEGPSL EDL
    • Molecular weight
      22 kDa including tags
    • Amino acids
      1 to 180
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab167845 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 85 % SDS-PAGE.
    ab167845 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 30% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names
    • bK250D10.2
    • C22orf18
    • CENP M
    • Centromere protein M
    • ICEN 39
    • ICEN39
    • Interphase centromere complex protein 39
    • MGC861
    • OTTHUMP00000028741
    • PANE 1
    • PANE1
    • Proliferation associated nuclear element 1
    • Proliferation associated nuclear element protein 1
    see all
  • Relevance
    CENPM (Centromere protein M) is a component of the CENPA-NAC (nucleosome associated) complex, a complex that plays a central role in kinetochore protein assembly, mitotic cell cycle progression and chromosome segregation.
  • Cellular localization
    Cytoplasmic and Nuclear. Note: Nuclear in non confluent cells and cytoplasmic in confluent or dividing cells. Localizes in the kinetochore domain of centromeres.

Images

  • 15% SDS-PAGE analysis of 3µg ab167845.

References

ab167845 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167845.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up