Overview

  • Product name
    Recombinant Human CENPN protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDETVAEFIKRTILKIPMNELTTILKAWDFLSENQLQTVNFRQRKESVVQ HLIHLCEEKRASISDAALLDIIYMQFHQHQKVWDVFQMSKGPGEDVDLFD MKQFKNSFKKILQRALKNVTVSFRETEENAVWIRIAWGTQYTKPNQYKPT YVVYYSQTPYAFTSSSMLRRNTPLLGQELEATGKIYLRQEEIILDITEMK KACN
    • Amino acids
      1 to 204
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163249 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BM 039
    • BM 309
    • BM-309
    • BM039
    • C16orf60
    • CENP N
    • CENP-N
    • Cenpn
    • CENPN_HUMAN
    • Centromere protein N
    • FLJ13607
    • FLJ22660
    • ICEN 32
    • ICEN32
    • Interphase centromere complex protein 32
    see all
  • Function
    Component of the CENPA-NAC (nucleosome-associated) complex, a complex that plays a central role in assembly of kinetochore proteins, mitotic progression and chromosome segregation. The CENPA-NAC complex recruits the CENPA-CAD (nucleosome distal) complex and may be involved in incorporation of newly synthesized CENPA into centromeres. CENPN is the first protein to bind specifically to CENPA nucleosomes and the direct binding of CENPA nucleosomes by CENPN is required for centromere assembly. Required for chromosome congression and efficiently align the chromosomes on a metaphase plate.
  • Cellular localization
    Nucleus. Chromosome > centromere > kinetochore. Localizes exclusively in the kinetochore domain of centromeres. Kinetochore-bound levels decrease when cells enter mitosis and increase again when cells exit mitosis.
  • Information by UniProt

Images

  • ab163249 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163249 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163249.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up