Overview

  • Product name
    Recombinant Human CENPT protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MADHNPDSDSTPRTLLRRVLDTADPRTPRRPRSARAGARRALLETASPRK LSGQTRTIARGRSHGARSVGRSAHIQASGHLEEQTPRTLLKNILLTAPES SILMPESVVKPVPAPQAVQPSRQESSCGSLELQLPELEPPTTLAPGLLAP GRRKQRLRLSVFQQGVDQGLSLSQEPQGNADASSLTRSLNLTFATPLQPQ SVQRPGLARRPPARRAVDVGAFLRDLRDTSLAPPNIVLEDTQPFSQPMVG SPNVYHSLPCTPHTGAEDAEQAAGRKTQSSGPGLQKNSECVALVAWSQI
    • Amino acids
      1 to 299
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164207 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C16orf56
    • CENP T
    • CENP-T
    • Cenpt
    • CENPT_HUMAN
    • Centromere protein T
    • Chromosome 16 open reading frame 56
    • ICEN22
    • Interphase centromere complex protein 22
    see all
  • Function
    Component of the CENPA-NAC (nucleosome-associated) complex, a complex that plays a central role in assembly of kinetochore proteins, mitotic progression and chromosome segregation. The CENPA-NAC complex recruits the CENPA-CAD (nucleosome distal) complex and may be involved in incorporation of newly synthesized CENPA into centromeres. CENP-T is one of the basic inner kinetochore proteins with most further proteins binding downstream, suggesting a fundamental role of CENP-T in kinetochore function.
  • Sequence similarities
    Belongs to the CENPT family.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus. Chromosome > centromere > kinetochore. Localizes exclusively in the kinetochore domain of centromeres.
  • Information by UniProt

Images

  • ab164207 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164207 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164207.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up