Recombinant Human Centaurin beta 2 protein (ab161673)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      DVINRVYEANVEKMGIKKPQPGQRQEKEAYIRAKYVERKFVDKYSISLSP PEQQKKFVSKSSEEKRLSISKFGPGDQVRASAQSSVRSNDSGIQQSSDDG RESLPSTVS
    • Amino acids
      473 to 581
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161673 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ACAP 2
    • ACAP2
    • ACAP2_HUMAN
    • ANK repeat and PH domain-containing protein 2
    • Arf GAP with coiled coil ANK repeat and PH domain containing protein 2
    • Arf GAP with coiled coil ANK repeat and PH domains 2
    • Arf-GAP with coiled-coil
    • ArfGAP with coiled coil ankyrin repeat and PH domains 2
    • CENT B 2
    • Centaurin beta2
    • Centaurin-beta-2
    • CENTB 2
    • CENTB2
    • Cnt b2
    • Cnt-b2
    • Cntb2
    • KIAA0041
    • Similar to yeast ZINC FINGER PROTEIN GCS1
    see all
  • Function
    GTPase-activating protein (GAP) for ADP ribosylation factor 6 (ARF6).
  • Tissue specificity
    Widely expressed. Highest level in lung.
  • Sequence similarities
    Contains 3 ANK repeats.
    Contains 1 Arf-GAP domain.
    Contains 1 BAR domain.
    Contains 1 PH domain.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Information by UniProt

Images

  • ab161673 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161673 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161673.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up