Recombinant Human Centrin 1 protein (ab114364)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ12798
    • SpeciesHuman
    • SequenceMASGFKKPSAASTGQKRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDA KELKVAMRALGFEPRKEEMKKMISEVDREGTGKISFNDFLAVMTQKMSEK
    • Molecular weight37 kDa including tags
    • Amino acids1 to 100

Specifications

Our Abpromise guarantee covers the use of ab114364 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Caltractin
    • Caltractin isoform 2
    • CEN 1
    • CEN1
    • Centrin EF hand protein 1
    • Centrin-1
    • Centrin1
    • CETN
    • CETN 1
    • CETN1
    • CETN1_HUMAN
    • EF hand protein 1
    see all
  • FunctionPlays a fundamental role in microtubule-organizing center structure and function.
  • Sequence similaritiesBelongs to the centrin family.
    Contains 4 EF-hand domains.
  • Cellular localizationCytoplasm > cytoskeleton > centrosome. Centrosome of interphase and mitotic cells.
  • Information by UniProt

Recombinant Human Centrin 1 protein images

  • 12.5% SDS-PAGE showing ab114364 at approximately 36.63kDa stained with Coomassie Blue.

References for Recombinant Human Centrin 1 protein (ab114364)

ab114364 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114364.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"