Recombinant Human Centrin 1 protein (ab114364)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASGFKKPSAASTGQKRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDA KELKVAMRALGFEPRKEEMKKMISEVDREGTGKISFNDFLAVMTQKMSEK
    • Molecular weight
      37 kDa including tags
    • Amino acids
      1 to 100

Specifications

Our Abpromise guarantee covers the use of ab114364 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Caltractin
    • Caltractin isoform 2
    • CEN 1
    • CEN1
    • Centrin EF hand protein 1
    • Centrin-1
    • Centrin1
    • CETN
    • CETN 1
    • CETN1
    • CETN1_HUMAN
    • EF hand protein 1
    see all
  • Function
    Plays a fundamental role in microtubule-organizing center structure and function.
  • Sequence similarities
    Belongs to the centrin family.
    Contains 4 EF-hand domains.
  • Cellular localization
    Cytoplasm > cytoskeleton > centrosome. Centrosome of interphase and mitotic cells.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114364 at approximately 36.63kDa stained with Coomassie Blue.

References

ab114364 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114364.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up