Recombinant Human Centrin 2 protein (ab116203)

Overview

  • Product nameRecombinant Human Centrin 2 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP41208
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMASNFKKANMASSSQRKRMSPKPELTEEQK QEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEG TGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVA KELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY
    • Molecular weight22 kDa including tags
    • Amino acids1 to 172
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116203 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab116203 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol, 0.58% Sodium chloride, 0.02% DTT

General Info

  • Alternative names
    • 20kD calcium binding protein
    • CALT
    • caltractin
    • Caltractin isoform 1
    • CEN2
    • centrin
    • centrin, EF hand protein, 2
    • Centrin-2
    • Centrin2
    • CETN2
    • CETN2_HUMAN
    • EF hand protein 2
    • EF-hand protein
    see all
  • FunctionPlays a fundamental role in microtubule-organizing center structure and function. Required for centriole duplication and correct spindle formation. Has a role in regulating cytokinesis and genome stability via cooperation with CALM1 and CEP110.
    Involved in global genome nucleotide excision repair (GG-NER) by acting as component of the XPC complex. Cooperatively with RAD23B appears to stabilize XPC. In vitro, stimulates DNA binding of the XPC:RAD23B dimer.
    The XPC complex is proposed to represent the first factor bound at the sites of DNA damage and together with other core recognition factors, XPA, RPA and the TFIIH complex, is part of the pre-incision (or initial recognition) complex. The XPC complex recognizes a wide spectrum of damaged DNA characterized by distortions of the DNA helix such as single-stranded loops, mismatched bubbles or single stranded overhangs. The orientation of XPC complex binding appears to be crucial for inducing a productive NER. XPC complex is proposed to recognize and to interact with unpaired bases on the undamaged DNA strand which is followed by recruitment of the TFIIH complex and subsequent scanning for lesions in the opposite strand in a 5'-to-3' direction by the NER machinery. Cyclobutane pyrimidine dimers (CPDs) which are formed upon UV-induced DNA damage esacpe detection by the XPC complex due to a low degree of structural perurbation. Instead they are detected by the UV-DDB complex which in turn recruits and cooperates with the XPC complex in the respective DNA repair.
  • Sequence similaritiesBelongs to the centrin family.
    Contains 4 EF-hand domains.
  • Cellular localizationCytoplasm > cytoskeleton > centrosome > centriole. Nucleus. Centrosome of S-phase, interphase and mitotic cells.
  • Information by UniProt

Recombinant Human Centrin 2 protein images

  • 15% SDS-PAGE analysis of 3 µg ab116203.

References for Recombinant Human Centrin 2 protein (ab116203)

ab116203 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116203.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"