Recombinant Human CEP250 protein (ab161344)

Overview

  • Product name
    Recombinant Human CEP250 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LTVDWSRARDELMRKESQWQMEQEFFKGYLKGEHGRLLSLWREVVTFRRH FLEMKSATDRDLMELKAEHVRLSGSLLTCCLRLTVGAQSREPNGSGRMDG
    • Amino acids
      141 to 240
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161344 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C Nap1
    • Centrosomal Nek2 associated protein 1
    • Centrosomal protein 2
    • Centrosomal protein 250 KD
    • Centrosomal protein 250kDa
    • Centrosome associated protein
    • Centrosome associated protein CEP250
    • CEP 2
    • CEP 250
    • CEP2
    • CNAP 1
    • CNAP1
    • MGC88542
    see all
  • Relevance
    CEP250 (Centrosome associated protein CEP250) is a core centrosomal protein which may play an important role in centrosome cohesion during interphase. It dissociates from the centrosomes when parental centrioles separate at the beginning of mitosis. CEP250 is phosphorylated by NIMA-related kinase 2 (NEK2).
  • Cellular localization
    Cytoplasm, perinuclear region. Centrosome, centriole. Cell projection, cilium basal body. Note=Component of the core centrosome. In interphase cells, it specifically associates with the proximal ends of both mother and daughter centrioles. Associates with the centrosome in interphase cells. In mitotic cells, it dissociates from the mitotic spindle poles. At the end of cell division, it reaccumulates at centrosomes. In photoreceptors, found at the proximal ends of basal bodies.

Images

  • ab161344 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161344 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161344.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up