Overview

  • Product name
    Recombinant Human CEP55 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSSRSTKDLIKSKWGSKPSNSKSETTLEKLKGEIAHLKASVDEITSGKGK LTDKERHRLLEKIRVLEAEKEKNAYQLTEKDKEIQRLRDQLKARYSTTAL LEQLEETTREGERREQVLKALSEEKDVLKQQLSAATSRIAELESKTNTLR LSQTVAPNCFNSSINNIHEMEIQLKDALEKNQQWLVYDQQREVYVKGLLA KIFELEKKTETAAHSLPQQTKKPESEGYLQEEKQKCYNDLLASAKKDLEV ERQTITQLSFELSEFRRKYEETQKEVHNLNQLLYSQRRADVQHLEDDRHK TEKIQKLREENDIARGKLEEEKKRSEELLSQVQFLYTSLLKQQEEQTRVA LLEQQMQACTLDFENEKLDRQHVQHQLLVILKELRKARNQITQLESLKQL HEFAITEPLVTFQGETENREKVAASPKSPTAALNESLVECPKCNIQYPAT EHRDLLVHVEYCSK
    • Amino acids
      1 to 464
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162993 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C10orf3
    • cancer/testis antigen 111
    • Centrosomal protein 55kDa
    • Centrosomal protein of 55 kDa
    • CEP 55
    • Cep55
    • CEP55_HUMAN
    • CT111
    • FLJ10540
    • Up regulated in colon cancer 6
    • Up-regulated in colon cancer 6
    • URCC 6
    • URCC6
    see all
  • Function
    Plays a role in mitotic exit and cytokinesis. Not required for microtubule nucleation. Recruits PDCD6IP and TSG101 to midbody during cytokinesis.
  • Tissue specificity
    Widely expressed, mostly in proliferative tissues. Highly expressed in testis. Intermediate levels in adult and fetal thymus, as well as in various cancer cell lines. Low levels in different parts of the digestive tract, bone marrow, lymph nodes, placenta, fetal heart and fetal spleen. Hardly detected in brain.
  • Post-translational
    modifications
    There is a hierachy of phosphorylation, where both Ser-425 and Ser-428 are phosphorylated at the onset of mitosis, prior to Ser-436. Phosphorylation at Ser-425 and Ser-428 is required for dissociation from the centrosome at the G2/M boundary. Phosphorylation at the 3 sites, Ser-425, Ser-428 and Ser-436, is required for protein function at the final stages of cell division to complete cytokinesis successfully.
  • Cellular localization
    Cytoplasm > cytoskeleton > centrosome > centriole. Cytoplasm > cytoskeleton > centrosome. Cleavage furrow. Midbody. Present at the centrosomes at interphase. A small portion is associated preferentially with the mother centriole, whereas the majority localizes to the pericentriolar material. During mitosis, loss of affinity for the centrosome at the onset of prophase and diffusion throughout the cell. This dissociation from the centrosome is phosphorylation-dependent. May remain localized at the centrosome during mitosis in certain cell types. Appears at the cleavage furrow in late anaphase and in the midbody in cytokinesis.
  • Information by UniProt

Images

  • ab162993 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162993 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162993.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up