Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAAASVSAASGSHLSNSFAEPSRSNGSMVRHSSSPYVVYPSDKPFLNSDL RRSPSKPTLAYPESNSRAIFSALKNLQDKIRRLELERIQAEESVKTLSRE TIEYKKVLDEQIQERENSKNEESKHNQELTSQLLAAENKCNLLEKQLEYM RNMIKHAEMERTSVLEKQVSLERERQHDQTHVQSQLEKLDLLEQEYNKLT TMQALAEKKMQELEAKLHEEEQERKRMQAKAAELQTGLETNRLIFEDKAT PCVPNARRIKKKKSKPPEKKSSRNYFGAQPHYRLCLGDMPFVAGKSTSPS HAVVANVQLVLHLMKQHSKALCNDRVINSIPLAKQVSSRGGKSKKLSVTP PSSNGINEELSEVLQTLQDEFGQMSFDHQQLAKLIQESPTVELKDKLECE LEALVGRMEAKANQITKVRKYQAQLEKQKLEKQKKELKATKKTLDEERNS SSRSGITGTTNKKDFMKLRPGEKRRKNLQLLKDMQSIQNSLQSSSLCWDY
    • Amino acids
      1 to 500
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153010 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Centrosomal protein 57kDa
    • Centrosomal protein of 57 kDa
    • Cep57
    • Cep57 protein
    • CEP57_HUMAN
    • FGF2 interacting protein
    • FGF2-interacting protein
    • KIAA0092
    • MVA2
    • PIG8
    • Proliferation inducing protein 8
    • Testis specific protein 57
    • Testis-specific protein 57
    • Translokin
    • TSP57
    see all
  • Function
    Centrosomal protein which may be required for microtubule attachment to centrosomes. May act by forming ring-like structures around microtubules. Mediates nuclear translocation and mitogenic activity of the internalized growth factor FGF2.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the translokin family.
  • Domain
    The C-terminal region mediates the interaction with microtubules and is able to nucleate and bundles microtubules in vitro.
    The centrosome localization domain (CLD) region mediates the localization to centrosomes and homooligomerization.
  • Cellular localization
    Nucleus. Cytoplasm. Cytoplasm > cytoskeleton > centrosome.
  • Information by UniProt

Images

  • ab153010 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153010 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153010.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up