Overview

  • Product name
    Recombinant Human CEP76 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSLPPEKASELKQLIHQQLSKMDVHGRIREILAETIREELAPDQQHLSTE DLIKALRRRGIIDDVMKELNFVTDSVEQELPSSPKQPICFDRQSTLKKTN IDPTRRYLYLQVLGGKAFLEHLQEPEPLPGQVCSTFTLCLHYRNQRFRSK PVPCACEPDFHDGFLLEVHRESLGDGTRMADSTTMLSISDPIHMVLIKTD IFGETTLVASYFLEWRSVLGSENGVTSLTVELMGVGTESKVSVGILNIKL EMYPPLNQTLSQEVVNTQLALERQKTAEKERLFLVYAKQWWREYLQIRPS HNSRLVKIFAQDENGINRPVCSYVKPLRAGRLLDTPRQAARFVNVLGYER APVIGGGGKQEQWCTLLAFLCRNKGDCEDHANLLCSLLLGYGLEAFVCVG TKAKGVPHAWVMTCGTDGAITFWESLTGHRYIHKPTNPDEPPVAEQPKPL YPYRTIGCVFNHQMFLGNCQPSDAVETCVFDLNDESKWKPMSEEAIKSVC APGATTSLPPFPPLCASTIDASVTSNEIEMQLRLLVSEHRKDLGLTTVWE DQLSYLLSPALASYEFERTTSISAGNEEFQDAIRRAVPDGHTFKGFPIHF VYRNARRAFATCLRSPFCEEIICCRGDQVRLAVRVRVFTYPESACAVWIM FACKYRSVL
    • Amino acids
      1 to 659
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164167 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C18orf9
    • Centrosomal protein 76kDa
    • Centrosomal protein of 76 kDa
    • CEP 76
    • Cep76
    • CEP76_HUMAN
    • Chromosome 18 open reading frame 9
    • FLJ12542
    • HsT1705
    see all
  • Function
    Centrosomal protein involved in regulation of centriole duplication. Required to limit centriole duplication to once per cell cycle by preventing centriole reduplication.
  • Sequence similarities
    Belongs to the CEP76 family.
  • Developmental stage
    Expressed at low level in G1 and is induced in S and G2 phase, during which point centrioles have already commenced duplication (at protein level).
  • Cellular localization
    Cytoplasm > cytoskeleton > centrosome. Cytoplasm > cytoskeleton > centrosome > centriole. Does not localize along the ciliary axoneme.
  • Information by UniProt

Images

  • ab164167 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164167 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164167.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up