Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      HWETCRTVPFSQTITHEGCEKVVVQNNLCFGKCGSVHFPGAAQHSHTSCS HCLPAKFTTMHLPLNCTELSSVIKVVMLVEECQCKVKTEHEDGHILHAGS QDSFIPGVS
    • Amino acids
      158 to 266
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160450 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CER 1
    • cer1
    • CER1_HUMAN
    • Cerberus
    • Cerberus 1
    • Cerberus 1 (Xenopus laevis) homolog (cysteine knot superfamily)
    • Cerberus 1 cysteine knot superfamily homolog (Xenopus laevis)
    • Cerberus related 1
    • Cerberus related protein
    • Cerberus-related protein
    • Cerberus1
    • DAN domain family member 4
    • DAND 4
    • DAND4
    • MGC119894
    • MGC119895
    • MGC96951
    see all
  • Function
    Cytokine that may play a role in anterior neural induction and somite formation during embryogenesis in part through a BMP-inhibitory mechanism. Can regulate Nodal signaling during gastrulation as well as the formation and patterning of the primitive streak.
  • Sequence similarities
    Belongs to the DAN family.
    Contains 1 CTCK (C-terminal cystine knot-like) domain.
  • Post-translational
    modifications
    N-glycosylated.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab160450 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160450 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160450.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up