Recombinant Human Ceramide glucosyltransferase protein (ab152785)

Overview

  • Product name
    Recombinant Human Ceramide glucosyltransferase protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      TRLHLNKKATDKQPYSKLPGVSLLKPLKGVDPNLINNLETFFELDYPKYE VLLCVQDHDDPAIDVCKKLLGKYPNVDARLFIGGKKVGINPKINNLMPG
    • Molecular weight
      37 kDa including tags
    • Amino acids
      33 to 131

Specifications

Our Abpromise guarantee covers the use of ab152785 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/µl.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CEGT_HUMAN
    • Ceramide glucosyltransferase
    • GCS
    • GLCT 1
    • GLCT-1
    • GLCT1
    • Glucosylceramide synthase
    • UDP glucose ceramide glucosyltransferase
    • UDP glucose N acylsphingosine D glucosyltransferase
    • UDP-glucose ceramide glucosyltransferase
    • UDP-glucose:N-acylsphingosine D-glucosyltransferase
    • Ugcg
    see all
  • Function
    Catalyzes the first glycosylation step in glycosphingolipid biosynthesis, the transfer of glucose to ceramide. May also serve as a "flippase".
  • Tissue specificity
    Found in all tissues examined.
  • Pathway
    Lipid metabolism; sphingolipid metabolism.
  • Sequence similarities
    Belongs to the glycosyltransferase 2 family.
  • Cellular localization
    Golgi apparatus membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab152785 stained with Coomassie Blue.

References

ab152785 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152785.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up