Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MQRGPASGDPREGPPRQRREGCWGLHTCLITAARLRQSGWEHDLGVCSGS TDDKLWKLAVCKALASLLLLKCQIPMLYIDAKCLTQPGLGAVRRKLAIRG GGAGPGLPQDSSEAGPEVCTRGPDLSLSFLHTEFSIFIEHLVLLSQSSVN CVSDVCLLPRSHDGSLVSSAARGLRRPEDSSRKAFLPRSPGHPSIVYYVL V
    • Amino acids
      1 to 201
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153492 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Acylsphingosine kinase
    • Ceramide kinase
    • Cerk
    • CERK1_HUMAN
    • dA59H18.2
    • dA59H18.3
    • hCERK
    • KIAA1646
    • Lipid kinase 4
    • Lipid kinase LK4
    • LK4
    see all
  • Function
    Catalyzes specifically the phosphorylation of ceramide to form ceramide 1-phosphate. Acts efficiently on natural and analog ceramides (C6, C8, C16 ceramides, and C8-dihydroceramide), to a lesser extent on C2-ceramide and C6-dihydroceramide, but not on other lipids, such as various sphingosines. Binds phosphoinositides.
  • Tissue specificity
    High level expression in heart, brain, skeletal muscle, kidney and liver; moderate in peripheral blood leukocytes and thymus; very low in spleen, small intestine, placenta and lung.
  • Sequence similarities
    Contains 1 DAGKc domain.
  • Cellular localization
    Cytoplasm. Membrane.
  • Information by UniProt

Images

  • ab153492 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153492 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153492.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up