Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      PPHMKADHGDELPFVFRSFFGGNYIKFTEEEEQLSRKMMKYWANFARNGN PNGEGLPHWPLFDQEEQYLQLNLQPAVGRALKAHRLQFWKKALPQKIQEL EEPEERHT
    • Amino acids
      514 to 621
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152919 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Carboxylesterase 2
    • Carboxylesterase 2 (intestine, liver)
    • CE-2
    • CES2
    • CES2A1
    • Cocaine esterase
    • EC 3.1.1.1
    • EST2_HUMAN
    • hCE-2
    • ICE
    • Iintestinal carboxylesterase liver carboxylesterase 2
    • Intestinal carboxylesterase; liver carboxylesterase-2
    • Methylumbelliferyl acetate deacetylase 2
    • PCE 2
    • PCE-2
    see all
  • Function
    Involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs. Shows high catalytic efficiency for hydrolysis of cocaine, 4-methyumbelliferyl acetate, heroin and 6-monoacetylmorphine.
  • Tissue specificity
    Preferentially expressed in intestine with moderate expression in liver. Within the intestine, highest expression is found in small intestine with lower expression in colon and rectum.
  • Sequence similarities
    Belongs to the type-B carboxylesterase/lipase family.
  • Post-translational
    modifications
    Glycosylated.
  • Cellular localization
    Endoplasmic reticulum lumen.
  • Information by UniProt

Images

  • ab152919 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152919 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152919.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up