Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP11597
    • SpeciesHuman
    • SequenceMLAATVLTLALLGNAHACSKGTSHEAGIVCRITKPALLVLNHETAKVIQT AFQRASYPDITGEKAMMLLGQVKYGLHNIQISHLSIASSQVELVEAKSID VSIQNVSVVFKGTLKYGYTTAWWLGIDQSIDFEIDSAIDLQINTQLTCDS GRVRTDAPDCYLSFHKLLLHLQGEREPGWIKQLFTNFISFTLKLVLKGQI CKEINVISNIMADFVQTRAASILSDGDIGVDISLTGDPVITASYLESHHK GHFIYKNVSEDLPLPTFSPTLLGDSRMLYFWFSERVFHSLAKVAFQDGRL MLSLMGDEFKAVLETWGFNTNQEIFQEVVGGFPSQAQVTVHCLKMPKISC QNKGVVVNSSVMVKFLFPRPDQQHSVAYTFEEDIVTTVQASYSKKKLFLS LLDFQITPKTVSNLTESSSESIQSFLQSMITAVGIPEVTSRLEVVFTALM NSKGVSLFDIINPEIITRDGFLLLQMDFGFPEHLLVDFLQSLS
    • Molecular weight80 kDa including tags
    • Amino acids1 to 493

Specifications

Our Abpromise guarantee covers the use of ab114408 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BPIFF
    • CETP
    • CETP_HUMAN
    • Cholesteryl ester transfer protein
    • Cholesteryl ester transfer protein plasma
    • HDLCQ10
    • Lipid transfer protein I
    see all
  • FunctionInvolved in the transfer of insoluble cholesteryl esters in the reverse transport of cholesterol.
  • Tissue specificityExpressed by the liver and secreted in plasma.
  • Involvement in diseaseDefects in CETP are a cause of hyperalphalipoproteinemia (HYPALIP) [MIM:143470]. Affected individuals show high levels of alpha-lipoprotein (high density lipoprotein/HDL).
    Defects in CETP are the cause of cholesteryl ester transfer protein deficiency (CETP deficiency) [MIM:607322]. This is an autosomal dominant condition associated with increased HDL cholesterol levels.
  • Sequence similaritiesBelongs to the BPI/LBP/Plunc superfamily. BPI/LBP family.
  • Cellular localizationSecreted > extracellular space.
  • Information by UniProt

Recombinant Human CETP protein images

  • 12.5% SDS-PAGE analysis of ab114408 stained with Coomassie Blue.

References for Recombinant Human CETP protein (ab114408)

ab114408 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114408.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"