Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      EATFCDFPKINHGILYDEEKYKPFSQVPTGEVFYYSCEYNFVSPSKSFWT RITCTEEGWSPTPKCLRLCFFPFVENGHSESSGQTHLEGDTVQIICNTGY RLQNNENNISCVERGWSTPPKCRSTDTSCVNPPTVQNAHILSRQMSKYPS GERVRYECRSPYEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGD ITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVI SREIMENYNIALRWTAKQKLYLRTGESAEFVCKRGYRLSSRSHTLRTTCW DGKLEYPTCAKR
    • Molecular weight
      60 kDa including tags
    • Amino acids
      19 to 330

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116914 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CFHL
    • CFHL1
    • CFHL1P
    • CFHR1
    • CFHR1P
    • Complement factor H related 1
    • Complement factor H related 1 pseudogene
    • Complement factor H related protein 1 precursor
    • Complement factor H-related protein 1
    • FHR 1
    • FHR-1
    • FHR1
    • FHR1_HUMAN
    • H factor (complement) like 1
    • H factor (complement) like 2
    • H factor like protein 1
    • H factor-like protein 1
    • H-factor-like 1
    • H36
    • H36 1
    • H36 2
    • HFL1
    • HFL2
    • MGC104329
    see all
  • Function
    Might be involved in complement regulation. Can associate with lipoproteins and may play a role in lipid metabolism.
  • Tissue specificity
    Expressed by the liver and secreted in plasma.
  • Sequence similarities
    Contains 5 Sushi (CCP/SCR) domains.
  • Post-translational
    modifications
    N-glycosylated. Two forms are observed; one with a single side chain and the other with two.
  • Cellular localization
    Secreted.
  • Information by UniProt

Recombinant Human CFHL1 protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116914 at approximately 60.43 kDa.

References for Recombinant Human CFHL1 protein (ab116914)

ab116914 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116914.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up