Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      EATFCDFPKINHGILYDEEKYKPFSQVPTGEVFYYSCEYNFVSPSKSFWT RITCTEEGWSPTPKCLRLCFFPFVENGHSESSGQTHLEGDTVQIICNTGY RLQNNENNISCVERGWSTPPKCRSTDTSCVNPPTVQNAHILSRQMSKYPS GERVRYECRSPYEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGD ITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVI SREIMENYNIALRWTAKQKLYLRTGESAEFVCKRGYRLSSRSHTLRTTCW DGKLEYPTCAKRVDHHHHHH
    • Molecular weight
      37 kDa including tags
    • Amino acids
      19 to 330
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152006 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 7.40
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names
    • CFHL
    • CFHL1
    • CFHL1P
    • CFHR1
    • CFHR1P
    • Complement factor H related 1
    • Complement factor H related 1 pseudogene
    • Complement factor H related protein 1 precursor
    • Complement factor H-related protein 1
    • FHR 1
    • FHR-1
    • FHR1
    • FHR1_HUMAN
    • H factor (complement) like 1
    • H factor (complement) like 2
    • H factor like protein 1
    • H factor-like protein 1
    • H-factor-like 1
    • H36
    • H36 1
    • H36 2
    • HFL1
    • HFL2
    • MGC104329
    see all
  • Function
    Might be involved in complement regulation. Can associate with lipoproteins and may play a role in lipid metabolism.
  • Tissue specificity
    Expressed by the liver and secreted in plasma.
  • Sequence similarities
    Contains 5 Sushi (CCP/SCR) domains.
  • Post-translational
    modifications
    N-glycosylated. Two forms are observed; one with a single side chain and the other with two.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab152006 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152006.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up